Protein Info for Rru_A0339 in Rhodospirillum rubrum S1H

Annotation: Short-chain dehydrogenase/reductase SDR (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 PF01370: Epimerase" amino acids 12 to 174 (163 residues), 31.1 bits, see alignment E=2.4e-11 PF00106: adh_short" amino acids 12 to 196 (185 residues), 133.3 bits, see alignment E=1.2e-42 PF13561: adh_short_C2" amino acids 19 to 258 (240 residues), 143.7 bits, see alignment E=1.1e-45

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A0339)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXK1 at UniProt or InterPro

Protein Sequence (263 amino acids)

>Rru_A0339 Short-chain dehydrogenase/reductase SDR (NCBI) (Rhodospirillum rubrum S1H)
MSFDLGLSGARALVTGGTKGIGAAVVGALRDAGVRVVTTARRVPANPADPANPVHCLAAD
MTTAEGCDAVAKYAIDRLGGVDIIVHVVGGSSAPAGGFAALDDAEWSRALNWNLMPAVRL
DRALLPGMIARGAGVIVHITSIQTRLPLPESTTAYAAAKAALASYSKSLSKEVAAKGIRV
VRVSPGWVETEAAVAMAERLAEQAGTDYAGGKQIIMKALGGIPLGRPAKPTEVADLVAFV
VSPRAGAVTGTEFVIDGGTVPTV