Protein Info for Rru_A0331 in Rhodospirillum rubrum S1H

Annotation: Protein of unknown function DUF6, transmembrane (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 45 to 67 (23 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 143 to 165 (23 residues), see Phobius details amino acids 171 to 189 (19 residues), see Phobius details amino acids 201 to 220 (20 residues), see Phobius details amino acids 231 to 251 (21 residues), see Phobius details amino acids 263 to 281 (19 residues), see Phobius details amino acids 287 to 306 (20 residues), see Phobius details PF00892: EamA" amino acids 22 to 156 (135 residues), 28.5 bits, see alignment E=8.3e-11 amino acids 171 to 300 (130 residues), 63.4 bits, see alignment E=1.4e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A0331)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXK9 at UniProt or InterPro

Protein Sequence (322 amino acids)

>Rru_A0331 Protein of unknown function DUF6, transmembrane (NCBI) (Rhodospirillum rubrum S1H)
MSAPASGFSAPRSPKAPVDWAPWMVLISTIALSFKGISAKYAYDAGMGVGMVLILRFVLA
APFFWVGERLLGAGRPRLPLGWAEIRPCILAGVLFSVATYSDFSSVQLIGAGLSRVILFT
YPAVILIIGAFSRRTWPARRQMLAFAITYLGLLIIIVPSVGLVAVDVMLEGVAMSLLSSV
TYGSFLVYSQSLTGRLGSARFTAISNTVTMLMIVPFALAMGGDLTIPNTTALIWAVVIAT
VCTVLPFFLLFEGIRRWGAEKTGLMTLSGPALTIAMAWVLLDETLTPLQLIGFAVVMAGV
GALQGVDRPLLRLLRRGRRAEA