Protein Info for Rru_A0318 in Rhodospirillum rubrum S1H

Annotation: 4Fe-4S ferredoxin, iron-sulfur binding (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 175 PF12797: Fer4_2" amino acids 35 to 54 (20 residues), 25.1 bits, see alignment (E = 4.3e-09) PF13237: Fer4_10" amino acids 36 to 87 (52 residues), 35.3 bits, see alignment E=3e-12 PF12837: Fer4_6" amino acids 36 to 57 (22 residues), 27.6 bits, see alignment (E = 7.2e-10) PF00037: Fer4" amino acids 36 to 54 (19 residues), 28.8 bits, see alignment (E = 2.7e-10) amino acids 70 to 91 (22 residues), 27.9 bits, see alignment (E = 5.2e-10) PF12838: Fer4_7" amino acids 42 to 90 (49 residues), 48.5 bits, see alignment E=3.5e-16 PF13187: Fer4_9" amino acids 42 to 91 (50 residues), 31.6 bits, see alignment E=4.9e-11

Best Hits

KEGG orthology group: K05903, NADH dehydrogenase (quinone) [EC: 1.6.99.5] (inferred from 100% identity to rru:Rru_A0318)

Predicted SEED Role

"Formate hydrogenlyase complex 3 iron-sulfur protein; Formate hydrogenlyase subunit 6; Ni,Fe-hydrogenase III medium subunit"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.99.5

Use Curated BLAST to search for 1.6.99.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXM2 at UniProt or InterPro

Protein Sequence (175 amino acids)

>Rru_A0318 4Fe-4S ferredoxin, iron-sulfur binding (NCBI) (Rhodospirillum rubrum S1H)
MLSKIKEALICLRAGRVTLPYPFVPLKAPPRFRGRPTIDGAKCIGCGACAEVCPPRLIEV
NDAASTRTVELNYSRCTYCARCQEICPTGAMTCTEDFEMATADRKNLTVSVQLDMVHCET
CGKAFMTKRMLDKMLTEFCPPWMNKKIDVPKWLWQCPQCRLDKTGSVIEGSIKNG