Protein Info for Rru_A0315 in Rhodospirillum rubrum S1H

Annotation: NADH dehydrogenase (quinone) (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 674 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 36 to 61 (26 residues), see Phobius details amino acids 81 to 104 (24 residues), see Phobius details amino acids 116 to 133 (18 residues), see Phobius details amino acids 139 to 156 (18 residues), see Phobius details amino acids 168 to 193 (26 residues), see Phobius details amino acids 213 to 238 (26 residues), see Phobius details amino acids 250 to 274 (25 residues), see Phobius details amino acids 281 to 302 (22 residues), see Phobius details amino acids 321 to 346 (26 residues), see Phobius details amino acids 352 to 371 (20 residues), see Phobius details amino acids 383 to 405 (23 residues), see Phobius details amino acids 430 to 453 (24 residues), see Phobius details amino acids 481 to 503 (23 residues), see Phobius details amino acids 539 to 562 (24 residues), see Phobius details amino acids 654 to 673 (20 residues), see Phobius details PF00662: Proton_antipo_N" amino acids 70 to 117 (48 residues), 32.8 bits, see alignment 5.3e-12 PF00361: Proton_antipo_M" amino acids 134 to 441 (308 residues), 203.7 bits, see alignment E=3.9e-64

Best Hits

KEGG orthology group: K05903, NADH dehydrogenase (quinone) [EC: 1.6.99.5] (inferred from 100% identity to rru:Rru_A0315)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.99.5

Use Curated BLAST to search for 1.6.99.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXM5 at UniProt or InterPro

Protein Sequence (674 amino acids)

>Rru_A0315 NADH dehydrogenase (quinone) (NCBI) (Rhodospirillum rubrum S1H)
MSTTQVFLGAFAVLAALPVLTLLAGNRKSLAGSITLVGVGVACLAMLGLAVTALTVGPIA
FDLGTVPLFGLTSSLAFTIDGLSAIFVILISVLGTASALYSVGYIAHYPDEDARRYYVPF
PLFIAGMLMVATTSDWFCFFFGWEFMTLVSYFLVTFENRDKENLSAGFIYFFMTQLTSMG
LMLAIIVLGTWGGSTSFAAVAKTLGALQAENPVALYGLLSLFFIGFATKAGMFPLGIWLP
KAHPAAPASVSALLSGVMIKLGIYGMLRIFLWALPLGEATHVWGMVITLFGVLSMLVGTL
RALGEHDCKRLLAQHSIGQMGYVLLGLGLGLTFLGSNPLFAALGFLGCLYHLINHACFKS
LLFFNTGSILYRAGTRDLDSLGGLSAVMPLTAGCALVGALSIAGTPPFNGFVSKWLLYQS
AIFGDVSTPVYILAAVVAIFIGTVTLASFVKYMGTAYLGTLPKRFVGSGFGCPRSMEAVE
VFLAVVCLVMGVFPGPVVATLLGVLDPAFAGAGVDLGPSVLSALPWSGLSVTSASGTTLT
VFAPLVVIGGLAVSFALSALIHGAVKVPSRPAQIWNCGEEIDDELVRYRASSFYSPFKKL
IAPVYRQHPFPTLSLPALLPRLLDLDKWLYFPIGALFRKSSKAISRAHTGVPQLYLSWQV
AGGALAIVFALWLM