Protein Info for Rru_A0305 in Rhodospirillum rubrum S1H

Annotation: Hydrogenase expression/formation protein HypE (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 TIGR02124: hydrogenase expression/formation protein HypE" amino acids 10 to 341 (332 residues), 447.3 bits, see alignment E=1.4e-138 PF00586: AIRS" amino acids 43 to 154 (112 residues), 86.4 bits, see alignment E=1.8e-28 PF02769: AIRS_C" amino acids 167 to 314 (148 residues), 91.1 bits, see alignment E=8.4e-30

Best Hits

Swiss-Prot: 59% identical to HYPE_RHILV: Carbamoyl dehydratase HypE (hypE) from Rhizobium leguminosarum bv. viciae

KEGG orthology group: K04655, hydrogenase expression/formation protein HypE (inferred from 100% identity to rru:Rru_A0305)

Predicted SEED Role

"[NiFe] hydrogenase metallocenter assembly protein HypE" in subsystem NiFe hydrogenase maturation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXN5 at UniProt or InterPro

Protein Sequence (341 amino acids)

>Rru_A0305 Hydrogenase expression/formation protein HypE (NCBI) (Rhodospirillum rubrum S1H)
MSRLDLTTGRIDMTHGAGGRAMQGLIERLFHAAFDDPVLVRADDAAVLPAADGPLVMSTD
GFVVSPLFFPGGDIGSLAVHGTVNDLSMMGARPLYLSSAFIIEEGFALADLERIVASMAA
AARAAGVRIVTGDTKVVDRGKADGLFITTAGIGVGRVGVHPAADRARAGDRILVNGPLGD
HGVAVLSARGQIGLNVPVHSDSAALNGLVEAMIAVDADLHCLRDATRGGVAAVLNELCDR
SRVGMTIEESALPVRPAVQGACEALGLDPLDLANEGKLVAVVDAASAQAVLAAMRAHPLG
RDAALIGTVVDDPDHLVEMTTRFGGRRLIQWRAGEALPRIC