Protein Info for Rru_A0302 in Rhodospirillum rubrum S1H

Annotation: Hydrogenase accessory protein HypB (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 TIGR00073: hydrogenase accessory protein HypB" amino acids 79 to 287 (209 residues), 275.5 bits, see alignment E=1.4e-86 PF02492: cobW" amino acids 106 to 251 (146 residues), 76.9 bits, see alignment E=7.6e-26

Best Hits

Swiss-Prot: 47% identical to HYPB_RHOCA: Hydrogenase maturation factor HypB (hypB) from Rhodobacter capsulatus

KEGG orthology group: K04652, hydrogenase nickel incorporation protein HypB (inferred from 100% identity to rru:Rru_A0302)

Predicted SEED Role

"[NiFe] hydrogenase nickel incorporation-associated protein HypB" in subsystem NiFe hydrogenase maturation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXN8 at UniProt or InterPro

Protein Sequence (296 amino acids)

>Rru_A0302 Hydrogenase accessory protein HypB (NCBI) (Rhodospirillum rubrum S1H)
MCETCGCAGTGPHHVHGDHAHSHSHGDGHTHDHAHDHGHGHSHDHDHDHGHGHSHSHDHD
HGHSHSHGSASEGTRTVIVLEDLLAKNDHQAAHVRAHFDARGILAVNLMSSPGSGKTSLL
EATIQALPAGVRVAVIEGDLETENDAERIRRHGVPAVQITTGTACHLDAHMIHDALHHLD
LDGIDIVFIENVGNLVCPATFDIGQHRNVVLLSVTEGDDKPAKYPVIMRAADRVLITKAD
LLPHIEEFDVERARASIAGVAGPVPVCVVSSKRGPGMDDWIGWLMAEHAARKPAVA