Protein Info for Rru_A0290 in Rhodospirillum rubrum S1H

Annotation: Auxin Efflux Carrier (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 34 to 54 (21 residues), see Phobius details amino acids 60 to 84 (25 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 120 to 142 (23 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 182 to 200 (19 residues), see Phobius details amino acids 207 to 231 (25 residues), see Phobius details amino acids 237 to 257 (21 residues), see Phobius details amino acids 269 to 290 (22 residues), see Phobius details PF03547: Mem_trans" amino acids 151 to 286 (136 residues), 57.4 bits, see alignment E=5e-20

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 100% identity to rru:Rru_A0290)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXQ0 at UniProt or InterPro

Protein Sequence (294 amino acids)

>Rru_A0290 Auxin Efflux Carrier (NCBI) (Rhodospirillum rubrum S1H)
MFSIVFPVIAPVLIVVAVGFGWARAGRPFDTATVSALGLGLGTPFLLTDVLMSANIAADA
LAAMGLAALLTLAGMAVGGALTLRLLKLPQAVFLPSMIFGNTGNIALPLCLFAFGDEGLA
LSIGYFTVVIVIQFSATALISSGERPVPVILRNPVIWTLLVVGTLKAGGIALPGWLADTA
HMVGGMCIPVMLLALGVSLARLKVAGLGVALLLGAVKIALGVALGYATVLALDLHGAARG
VVLIQSAMPPAVFNYLFAARYNQRPEEVAGLVIVSTGLSVLTMPLLLWGAMADM