Protein Info for Rru_A0289 in Rhodospirillum rubrum S1H

Annotation: NUDIX hydrolase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 PF09296: NUDIX-like" amino acids 38 to 204 (167 residues), 46.7 bits, see alignment E=6.8e-16 PF09297: Zn_ribbon_NUD" amino acids 206 to 239 (34 residues), 35.8 bits, see alignment 7.6e-13 PF00293: NUDIX" amino acids 244 to 350 (107 residues), 74.2 bits, see alignment E=1.6e-24

Best Hits

KEGG orthology group: K03426, NAD+ diphosphatase [EC: 3.6.1.22] (inferred from 100% identity to rru:Rru_A0289)

Predicted SEED Role

"NADH pyrophosphatase (EC 3.6.1.22)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXQ1 at UniProt or InterPro

Protein Sequence (382 amino acids)

>Rru_A0289 NUDIX hydrolase (NCBI) (Rhodospirillum rubrum S1H)
MAQTGISDIVYTGARHDRVSTGTLDDKALEALGWRPEARWLVFWRGRIAFPATGPTPDPT
REPEPLSPLLLDGPTVRGLIAGRTTIPPTPADTPPALAELVAAGGDGLADLTLAPPAPPP
VTGPSHPTLHLGLLDGAALQVIDLSALPERPPTDAGEAGESDLAPDLRLADGSAPVFREL
RGVALAVEDAMAGAMAHAQALLNWHASHPLCPRCGAVTRIAAGGRHRHCANPACGADHFP
RTDPVVIMLVEDPEGERCLLARQSRFPAGMYSALAGFVEPGETLEAAVAREVREEAGLDV
GDIRYVASQPWPWPSNLMIGFIARARATALSLDDNELEDARWFTRAEVAAMGEVGDEGEG
FRIPRRDAIARHLVEGWRDRRF