Protein Info for Rru_A0280 in Rhodospirillum rubrum S1H

Annotation: Queuine tRNA-ribosyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 TIGR00430: tRNA-guanine transglycosylase" amino acids 6 to 366 (361 residues), 499.5 bits, see alignment E=5.6e-154 TIGR00449: tRNA-guanine family transglycosylase" amino acids 6 to 365 (360 residues), 486.6 bits, see alignment E=4.2e-150 PF01702: TGT" amino acids 14 to 366 (353 residues), 521.6 bits, see alignment E=5.6e-161

Best Hits

Swiss-Prot: 70% identical to TGT_RHOS4: Queuine tRNA-ribosyltransferase (tgt) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: K00773, queuine tRNA-ribosyltransferase [EC: 2.4.2.29] (inferred from 100% identity to rru:Rru_A0280)

MetaCyc: 58% identical to tRNA-guanine transglycosylase (Escherichia coli K-12 substr. MG1655)
tRNA-guanine transglycosylase. [EC: 2.4.2.29]

Predicted SEED Role

"tRNA-guanine transglycosylase (EC 2.4.2.29)" in subsystem Queuosine-Archaeosine Biosynthesis (EC 2.4.2.29)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXR0 at UniProt or InterPro

Protein Sequence (375 amino acids)

>Rru_A0280 Queuine tRNA-ribosyltransferase (NCBI) (Rhodospirillum rubrum S1H)
MTALSFTVKATEGKARLGRIETAHGPADTPIFMPVGTAATVKAMTPDSVRATGAQIVLGN
TYHLMLRPSAERIARLGGLHRFMGWSGPILTDSGGYQVMSLSKLRKLTEEGVTFQSHIDG
SRHLLTPERSMEIQDLLDATITMAFDECTPYPAERQTVAESMRMSMRWAERSRAAFRPRP
GYGLFGICQGGVHGDLRAESVAALTAIGFEGYAVGGLAVGEPQDEMFRVLDETCPLLPAD
RPRYLMGVGKPEDIVGAVLRGIDMFDCVMPTRSGRTAQGFTRRGEVNLRNARHRDDPRPL
DSACSCPACTSFSRAYLHHLVRAEEILGAMLLTWHNIQYYQDLMAGLRAAIGEQRLAAFV
TDFHTTRGLGDIEPV