Protein Info for Rru_A0278 in Rhodospirillum rubrum S1H

Annotation: Transcriptional Regulator, XRE family (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 PF12844: HTH_19" amino acids 25 to 87 (63 residues), 39.3 bits, see alignment E=8.2e-14 PF13560: HTH_31" amino acids 25 to 78 (54 residues), 29.3 bits, see alignment E=1.3e-10 PF01381: HTH_3" amino acids 28 to 82 (55 residues), 53.2 bits, see alignment E=3.6e-18

Best Hits

Swiss-Prot: 41% identical to Y668_RICCN: Uncharacterized HTH-type transcriptional regulator RC0668 (RC0668) from Rickettsia conorii (strain ATCC VR-613 / Malish 7)

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A0278)

Predicted SEED Role

"transcriptional regulator, Cro/CI family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXR2 at UniProt or InterPro

Protein Sequence (145 amino acids)

>Rru_A0278 Transcriptional Regulator, XRE family (NCBI) (Rhodospirillum rubrum S1H)
MDTVSVFTRVGGPTNRASEADRHVGKRIRERRVMLGLSQQQMADMIGVTYQQAHKYERGI
NRISAGRLFEIAQVLHVPVNYFFDGLDDEASETLSPRQRMCLELARNFAMIQNERHQEAL
SQLARALAAQVSVVEVIEECQAQRA