Protein Info for Rru_A0272 in Rhodospirillum rubrum S1H

Annotation: Small multidrug resistance protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 103 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 33 to 50 (18 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 84 to 102 (19 residues), see Phobius details PF00893: Multi_Drug_Res" amino acids 1 to 93 (93 residues), 90.1 bits, see alignment E=5.4e-30

Best Hits

Swiss-Prot: 58% identical to GDX_ECOL6: Guanidinium exporter (gdx) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K11741, quaternary ammonium compound-resistance protein SugE (inferred from 100% identity to rru:Rru_A0272)

MetaCyc: 57% identical to guanidinium exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-368; TRANS-RXN-369

Predicted SEED Role

"Quaternary ammonium compound-resistance protein SugE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXR8 at UniProt or InterPro

Protein Sequence (103 amino acids)

>Rru_A0272 Small multidrug resistance protein (NCBI) (Rhodospirillum rubrum S1H)
MAWVFLVLAGLCEVGWAVGLKMTEGFTRLVPSLLTALAMIASLGLLGLALRSLPLGVGYG
IWVGIGTVGAAVAGMALFGEAVSVVKLASLGLIIVGLIGLKIG