Protein Info for Rru_A0263 in Rhodospirillum rubrum S1H

Annotation: 4-diphosphocytidyl-2C-methyl-D-erythritol kinase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00154: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
  • amino acids 13 to 271 (259 residues), 160.5 bits, E=3.3e-51
• PF00288: GHMP_kinases_N
  • amino acids 96 to 152 (57 residues), 49.1 bits, E=6.1e-17
• PF08544: GHMP_kinases_C
  • amino acids 212 to 279 (68 residues), 40.8 bits, E=2.5e-14

Best Hits

Swiss-Prot: 100% identical to ISPE_RHORT: 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (ispE) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K00919, 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC: 2.7.1.148] (inferred from 100% identity to rru:Rru_A0263)

Predicted SEED Role

"4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC 2.7.1.148)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 2.7.1.148)

MetaCyc Pathways

• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (11/12 steps found)
• taxadiene biosynthesis (engineered) (11/13 steps found)
• methylerythritol phosphate pathway I (8/9 steps found)
• methylerythritol phosphate pathway II (8/9 steps found)
• isoprene biosynthesis I (8/10 steps found)
• superpathway of ergosterol biosynthesis II (12/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.148

Sequence Analysis Tools

See Q2RXS7 at UniProt or InterPro

Protein Sequence (304 amino acids)

>Rru_A0263 4-diphosphocytidyl-2C-methyl-D-erythritol kinase (NCBI) (Rhodospirillum rubrum S1H)
MTAVFPAADSVIEAACAKVNLTLHVTGRRANGYHDLDSLVVFSGAHDTLIACPAEGLSLA
MTGPTAALLDAEDDNIILRAARRLAERAGHRPDARLTLIKRLPVAAGIGGGSADGAATLR
ALSRLWKIALPQAEMLTLAAELGADVPVCLVGKAVTMAGIGDHLTPAPPLPEAWLLLVNP
RRAVPTPQVFKARQGGFSAANPLTESPASAQALAEALKRRTNDLAEPARRIEPVIDEVLR
TLAALPGCLLARMSGSGATCFGLFADQTSADFGMASLRETHGSWWASADRLIGDTARVPA
ALAV