Protein Info for Rru_A0259 in Rhodospirillum rubrum S1H

Annotation: Carbon starvation protein CstA (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 681 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 49 (21 residues), see Phobius details amino acids 83 to 105 (23 residues), see Phobius details amino acids 112 to 132 (21 residues), see Phobius details amino acids 152 to 177 (26 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details amino acids 212 to 230 (19 residues), see Phobius details amino acids 250 to 270 (21 residues), see Phobius details amino acids 278 to 297 (20 residues), see Phobius details amino acids 317 to 339 (23 residues), see Phobius details amino acids 360 to 386 (27 residues), see Phobius details amino acids 398 to 417 (20 residues), see Phobius details amino acids 430 to 452 (23 residues), see Phobius details amino acids 459 to 479 (21 residues), see Phobius details amino acids 506 to 524 (19 residues), see Phobius details amino acids 537 to 560 (24 residues), see Phobius details amino acids 568 to 588 (21 residues), see Phobius details amino acids 636 to 656 (21 residues), see Phobius details PF02554: CstA" amino acids 26 to 402 (377 residues), 583.4 bits, see alignment E=1.8e-179 PF13722: CstA_5TM" amino acids 457 to 585 (129 residues), 134.5 bits, see alignment E=2.5e-43

Best Hits

Swiss-Prot: 66% identical to CSTA_ECOLI: Peptide transporter CstA (cstA) from Escherichia coli (strain K12)

KEGG orthology group: K06200, carbon starvation protein (inferred from 100% identity to rru:Rru_A0259)

MetaCyc: 66% identical to pyruvate transporter CstA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-335

Predicted SEED Role

"Carbon starvation protein A paralog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXT1 at UniProt or InterPro

Protein Sequence (681 amino acids)

>Rru_A0259 Carbon starvation protein CstA (NCBI) (Rhodospirillum rubrum S1H)
MLGWLATAVLGAIALGVVALQRGESINAIWLVIAAVCTYFIAYRFYGLFIAKRVLGVDAN
RQTPAVRRNDGLDYVPTNRYVLFGHHFAAIAGAGPLVGPVLAAQMGYMPGTLWILAGVVF
AGAVQDSMVLFCSTRRDGRSLGDMIRTEMGPVAGAIGLVGVLLIMIIILAILALVVVKAL
AGSPWGTFTVFSTIPIALIMGVYSRFIRPGRIAEMSGIGFVLLMLALVYGQSVAESPTLA
PLFTYTGTELALIIIGYGFVASVLPVWLLLAPRDYLSTFLKIGVIVGLAIGIVIVMPDMK
MPAVTKFIDGTGPVFSGALFPFLFITIACGAVSGFHALISSGTTPKMIENENQVAFIGYG
GMLMESFVAIMAMVAACVIDPGVYFAMNSPAALIGTDAVNAAAVISSWGFAVTPDILTQT
AADVGESSILSRAGGAPTLAVGMAHIFSAVIGGKAMMGFWYHFAILFEALFILTAVDAGT
RACRFMVQDMIGSVVPAFKATRSWGNNLLATGISVSLWGYILYTGVTDPFGGINSLWPLF
GISNQMLAGMALIMITVILFKMKRQRHAWVSIIPATWLLICTTYAGLLKVFSPDPKIGFW
AQAQRFSTALDEGKILGPAKTVDHMRQVMFNNYLDAALAFAFVLVVAATLVYAVIAIRKA
QATSRPTALEVGGPTEVRTHA