Protein Info for Rru_A0257 in Rhodospirillum rubrum S1H

Annotation: Protein of unknown function DUF898 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 transmembrane" amino acids 30 to 51 (22 residues), see Phobius details amino acids 73 to 97 (25 residues), see Phobius details amino acids 106 to 125 (20 residues), see Phobius details amino acids 146 to 168 (23 residues), see Phobius details amino acids 200 to 228 (29 residues), see Phobius details amino acids 236 to 259 (24 residues), see Phobius details amino acids 288 to 308 (21 residues), see Phobius details PF05987: DUF898" amino acids 19 to 351 (333 residues), 352.8 bits, see alignment E=9.7e-110

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A0257)

Predicted SEED Role

"Thymidylate kinase (EC 2.7.4.9)" (EC 2.7.4.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.4.9

Use Curated BLAST to search for 2.7.4.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXT3 at UniProt or InterPro

Protein Sequence (358 amino acids)

>Rru_A0257 Protein of unknown function DUF898 (NCBI) (Rhodospirillum rubrum S1H)
MKDFAGPGPVPPAPSGAPLPVVFTGTARAYFRIWLVNLLLSLATIGIWSAWAKVRRRRYF
LGNTQVGGATFEYLATGLTLLKGRLIVVAALALYAGLQAIEPRVSWLLGLGYVVVLPWLI
VRSLAFNARNTQWCAVRFGFRARWWDGFVAAIAMPFLALISLGLLLPVSTRRTATFWVNG
HRLGAAAFSSAPPLAPLYRALGLALAVFMGMTALAGGAVWGGALALALAPGETGLALNTL
PLVGLLVIFPAFLFAGALYRARLRNTVLGAMTLEGGHRFRSTLSAPRFAWIVLSNMVVTV
LSLGLAHPWAAIRLWRYQCACLTVIPAGPLDAFIEARQAEGNVIASEFSDLEGFEVGL