Protein Info for Rru_A0215 in Rhodospirillum rubrum S1H

Annotation: Protein of unknown function DUF6, transmembrane (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 transmembrane" amino acids 23 to 41 (19 residues), see Phobius details amino acids 52 to 72 (21 residues), see Phobius details amino acids 84 to 108 (25 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details amino acids 201 to 220 (20 residues), see Phobius details amino acids 233 to 252 (20 residues), see Phobius details amino acids 262 to 283 (22 residues), see Phobius details amino acids 289 to 309 (21 residues), see Phobius details PF00892: EamA" amino acids 25 to 155 (131 residues), 74.9 bits, see alignment E=3.7e-25 amino acids 170 to 305 (136 residues), 54.7 bits, see alignment E=6.4e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A0215)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXX5 at UniProt or InterPro

Protein Sequence (334 amino acids)

>Rru_A0215 Protein of unknown function DUF6, transmembrane (NCBI) (Rhodospirillum rubrum S1H)
MSQPSALPAADSLAALHPGFKSSALVWLGVMVALWGFSWPVMKICVGLAPPLWLAAIRFT
SSGLCLFAFLACRGELRLPPRADWPIVASVGGLQMMAFTGLGLVAMQYTDAGRAALLAYT
TPLWAVVTAWIAFGQRPTAAQGVALCVGLSGVAVICSPADMDWGDSTVLLGNALLLLSAM
CWSFVILHVRRHRFTARPIDLAPWQMLLAALPLIVIAASVDGSPLTIAWTPELIGFLIYF
GPIATSACFVISSEYGRRVSAFAMSNITLGVPVIGMLSSIFLLGERVTVPLIIGLTLIVS
GVALAALAVNRKAAAGRADTALRSQAGKANWPTA