Protein Info for Rru_A0188 in Rhodospirillum rubrum S1H

Annotation: ABC transporter, transmembrane region (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 576 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details amino acids 60 to 84 (25 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 161 to 178 (18 residues), see Phobius details amino acids 241 to 272 (32 residues), see Phobius details amino acids 274 to 299 (26 residues), see Phobius details PF00664: ABC_membrane" amino acids 63 to 285 (223 residues), 69.2 bits, see alignment E=4.8e-23 PF00005: ABC_tran" amino acids 352 to 501 (150 residues), 105.8 bits, see alignment E=2.9e-34

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to rru:Rru_A0188)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RY02 at UniProt or InterPro

Protein Sequence (576 amino acids)

>Rru_A0188 ABC transporter, transmembrane region (NCBI) (Rhodospirillum rubrum S1H)
MIVLDVLRMADGPHAARVRRGMLFKIGETFCAAVPFAALYGALMLVFGEAPFGMGEILGL
TGLVAAGLAGQFAFGVLGARTAFISGYGMMGDFRFTMMDHLSKLPLGFFTFQRTGALTTT
VAENVKMVEEMFTKVVNEIVAGFTLPLFIGILLVVIDWRMGLAAVASVPLAFAVLRLTQG
RFMRLSAKRVDVHAEVSGRLLEYIDGLRVIRGYGLAGAKFASLRDSLDTQRRVSVALEIQ
GGLGIMAMAVVLEMGFIALLMVGAFAMLGGALSPASYLMAMVLAQKFYAPITRSLMLLVD
IKYLSLALKRVQTLLNAPRLPEPVEPKVPSNNAIVFDAVSFRYDEAGDEPALSEVTFTLR
EGTTTALVGPSGAGKSTVAHLIARFHDVTSGAVRIGGVDLRDMASDELMRRVSMVLQDVH
LFDDTVANNIRIGRSDASDEDVVAAARHAQCHAFIEALPQGYQAPIGEGGAWLSGGQKQR
LSIARALLKDAPIVLLDESTASLDPECEAAFHQAFKILAAGKTVLVIAHRLHTVVNADQI
VVMERGRVVQTGTHGDLIASPGLYRTLWTDMAEPTP