Protein Info for Rru_A0159 in Rhodospirillum rubrum S1H

Annotation: Exodeoxyribonuclease VII (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 537 PF13742: tRNA_anti_2" amino acids 15 to 107 (93 residues), 91.4 bits, see alignment E=5.4e-30 TIGR00237: exodeoxyribonuclease VII, large subunit" amino acids 16 to 357 (342 residues), 364.5 bits, see alignment E=3.8e-113 PF01336: tRNA_anti-codon" amino acids 35 to 109 (75 residues), 37.9 bits, see alignment E=2.1e-13 PF02601: Exonuc_VII_L" amino acids 131 to 356 (226 residues), 265.3 bits, see alignment E=1.4e-82 amino acids 325 to 491 (167 residues), 76.2 bits, see alignment E=5.2e-25

Best Hits

Swiss-Prot: 60% identical to EX7L_RHOCS: Exodeoxyribonuclease 7 large subunit (xseA) from Rhodospirillum centenum (strain ATCC 51521 / SW)

KEGG orthology group: K03601, exodeoxyribonuclease VII large subunit [EC: 3.1.11.6] (inferred from 100% identity to rru:Rru_A0159)

Predicted SEED Role

"Exodeoxyribonuclease VII large subunit (EC 3.1.11.6)" in subsystem DNA repair, bacterial (EC 3.1.11.6)

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.6

Use Curated BLAST to search for 3.1.11.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RY31 at UniProt or InterPro

Protein Sequence (537 amino acids)

>Rru_A0159 Exodeoxyribonuclease VII (NCBI) (Rhodospirillum rubrum S1H)
MIDTPNAPVHNLPELSVSELSGALKRTIEEAFSRVRVRGEISQPKVAGSGHCYLRLKDDQ
AVIDAIIWRGTMAKLALRPEEGLEVIAIGRLTTYPGRSSYQIVIESLELAGEGALLKMLE
ERRRRLAAEGLFDAGRKRRPPFLPSVIGVITSPTGAVIRDILHRLADRFPRPVLVWPVAV
QGEGAAAQIAAAITGFNALPAGGPVPRPDVLIVARGGGSLEDLMAFNDEAVVRAASASAI
PLISAVGHETDTTLIDHAADLRAPTPTGAAEMAVPVRLDLLAQVRERGGRLDGATLRLIE
ERRLRIEGLGRGLPDLARLIGTFAQRLDDRAERLEAALPRLLDRRADGVFHTAARLRGPG
EMIARKADALERAGRGLETGLARGLREAASRLDQRADRLRPGQIARLVAEGSRALTTLAG
RLDDLGRQTLVRRQDTLEGLGARLDNMSYRKVLERGYAVVRDATGAIVPAARGLTKGDGV
VLDFRDGRVAATIGEADPEAIPGQPAPETPPTAAGRSPARRPRSAGEGRQGDLLKDL