Protein Info for Rru_A0114 in Rhodospirillum rubrum S1H

Annotation: type II secretion system protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 transmembrane" amino acids 177 to 197 (21 residues), see Phobius details amino acids 217 to 242 (26 residues), see Phobius details amino acids 255 to 275 (21 residues), see Phobius details amino acids 281 to 302 (22 residues), see Phobius details amino acids 382 to 403 (22 residues), see Phobius details PF28597: T2SSF_N" amino acids 1 to 40 (40 residues), 30.5 bits, see alignment 2.5e-11 PF00482: T2SSF" amino acids 82 to 198 (117 residues), 79 bits, see alignment E=3.2e-26 amino acids 279 to 401 (123 residues), 81.6 bits, see alignment E=5.1e-27

Best Hits

KEGG orthology group: K02653, type IV pilus assembly protein PilC (inferred from 100% identity to rru:Rru_A0114)

Predicted SEED Role

"Type IV fimbrial assembly protein PilC" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RY76 at UniProt or InterPro

Protein Sequence (411 amino acids)

>Rru_A0114 type II secretion system protein (NCBI) (Rhodospirillum rubrum S1H)
MTLYAYRAVNARGRVVRGRLEAEGEGALQRGLLGAGLHLLAARPASRPDRRGPLAWIGGL
VGRRGAIAERELQQLFLHLDRALGAGVPLLEALDDIGEVTGDGRLRMILRRVRGDLSQGL
ALSDALGRHERALGPMVAPVVRAGEESGDLGGAFGPLVAHLRWREDLGRRLRKATRYPLV
VLGAIALLFVFLMAVVVPDLASFLGGLGEGLPPQTRALIGLSGLIVDHAFALGFLALAGL
LAPGLARRMSDEAAYRLDAWILALPLGGPLIRRIALSRFCHFFALMVGAGVPLAVCLATA
RGVLGNRCLAEALDTATAAVTAGHPLSDALRLSGQFPPLVTRMVRIGEDGGDLAGALGHV
SAFHDGDVAEATDRLIGLLEPALLLVAGGLLGWIVWAVLLPVYDSLIVLAG