Protein Info for Rru_A0108 in Rhodospirillum rubrum S1H

Annotation: Peptidase A24A, prepilin type IV (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 34 to 53 (20 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 147 to 176 (30 residues), see Phobius details amino acids 186 to 205 (20 residues), see Phobius details PF01478: Peptidase_A24" amino acids 69 to 176 (108 residues), 43.4 bits, see alignment E=2e-15

Best Hits

KEGG orthology group: K02654, leader peptidase (prepilin peptidase) / N-methyltransferase [EC: 2.1.1.- 3.4.23.43] (inferred from 100% identity to rru:Rru_A0108)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 3.4.23.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RY82 at UniProt or InterPro

Protein Sequence (208 amino acids)

>Rru_A0108 Peptidase A24A, prepilin type IV (NCBI) (Rhodospirillum rubrum S1H)
MGAGLGALAGLGAGGLAACLRASAAPPAHRLSFIRAGTLAGVGASCGIAFALLSPDTAAL
PYSLGAALVGVALLLAIAVIDIDLGVIHDILVLPLALVLLVWRIALGDGALSPLLSGAIA
FVLAQGLRLAYRAVRRREGLGAGDLGVIAAAGVALGPAEAPVFLMTAGVAGVVWGLASRR
YGDRPFPFAPALAFGLVMAMLARLGTLG