Protein Info for Rru_A0096 in Rhodospirillum rubrum S1H

Annotation: Secretion protein HlyD (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF16576: HlyD_D23" amino acids 44 to 262 (219 residues), 55.4 bits, see alignment E=1.1e-18 PF13533: Biotin_lipoyl_2" amino acids 48 to 90 (43 residues), 37.6 bits, see alignment 2.9e-13 PF13437: HlyD_3" amino acids 186 to 265 (80 residues), 53 bits, see alignment E=9.9e-18

Best Hits

KEGG orthology group: K01993, HlyD family secretion protein (inferred from 100% identity to rru:Rru_A0096)

Predicted SEED Role

"periplasmic component of efflux system"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RY94 at UniProt or InterPro

Protein Sequence (321 amino acids)

>Rru_A0096 Secretion protein HlyD (NCBI) (Rhodospirillum rubrum S1H)
MKLSSLLLALLLLIVVGGGGWLAWNRLMTPRLPEGIVVGSGRIEAREITLAAPLGGRIET
VLIEEGAVVEAGQPLARIDSPTLAPALSEARMRAAGAQAAQAEIAAPLAEAEAAMAAAHQ
EMERALVLQSRRQMSRQSVEQRRQGEEAARVALAEITARAEAIDREKTLAEAEVSRLKAL
MEGAEIRAPIGGQVLYRLVEPGDRLEAGDPVFTLLDPAKVFMTFFLDAENAGRVPKGAEA
RIVLEDHPDRVLAATLAFIAPDARVPSGVGGSAAPMVRVKAHLVPDPMGLPLGNLRTGLS
GHAFVRLTDTLPWPDRRALRP