Protein Info for Rru_A0092 in Rhodospirillum rubrum S1H

Annotation: extracellular solute-binding protein, family 1 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF01547: SBP_bac_1" amino acids 51 to 292 (242 residues), 97.9 bits, see alignment E=1.1e-31 PF13416: SBP_bac_8" amino acids 55 to 357 (303 residues), 84.4 bits, see alignment E=1.2e-27

Best Hits

Swiss-Prot: 52% identical to SP39_RHIME: Probable sugar-binding periplasmic protein (R03301) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02027, multiple sugar transport system substrate-binding protein (inferred from 100% identity to rru:Rru_A0092)

Predicted SEED Role

"ABC-type sugar transport system, periplasmic component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RY98 at UniProt or InterPro

Protein Sequence (425 amino acids)

>Rru_A0092 extracellular solute-binding protein, family 1 (NCBI) (Rhodospirillum rubrum S1H)
MRKTTGGGFGVSCLSALALVAGLAIAAPKPAAAGGSVEVLHWWTAGGEAKAVSALKDQFE
AEGGTWIDSPVAGGGGDAAMTALRSRVIAGNPPSAVQLKGPSIQEWAAEGVVANLDDIAK
AENWDKLLPALLKSVVTYEGHYVAVPVNIHRVDWLWANPAVLAKAGVAVPTTWDEFNTAA
EALKAKGIIPLAHGGQPWQDATLFEVVVLGLGGPAFYHKALVELDDAALRGDTMVKVFDQ
MRRLRGFVDPNFSGRDWNLATAMVINGEAGFQIMGDWAKGEFLGAGKVPGKDFLCIAAPG
KGFLLNSDSLVMFDVKGADKIEGQKTLARLVLGETFQRTFNTLKGSIPARQGMDLADFDA
CAQKSQADLTKAIAADSLEPSMAHEMAVPRSVRGAIMDVVTAHFNSSESSAEAVAHLADS
IAQAR