Protein Info for Rru_A0088 in Rhodospirillum rubrum S1H

Annotation: Zinc-containing alcohol dehydrogenase superfamily (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02817: zinc-binding alcohol dehydrogenase family protein
  • amino acids 2 to 340 (339 residues), 492.1 bits, E=4.9e-152
• PF08240: ADH_N
  • amino acids 31 to 89 (59 residues), 32.9 bits, E=7.5e-12
• PF00107: ADH_zinc_N
  • amino acids 164 to 250 (87 residues), 53.3 bits, E=4.2e-18
• PF13602: ADH_zinc_N_2
  • amino acids 197 to 337 (141 residues), 48.6 bits, E=2.5e-16

Best Hits

KEGG orthology group: K00344, NADPH2:quinone reductase [EC: 1.6.5.5] (inferred from 100% identity to rru:Rru_A0088)

Predicted SEED Role

"Bifunctional protein: zinc-containing alcohol dehydrogenase; quinone oxidoreductase ( NADPH:quinone reductase) (EC 1.1.1.-); Similar to arginate lyase" (EC 1.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of type II polyketide products
• Biosynthesis of unsaturated fatty acids
• Bisphenol A degradation
• Butanoate metabolism
• C21-Steroid hormone metabolism
• Fructose and mannose metabolism
• Glycine, serine and threonine metabolism
• Insect hormone biosynthesis
• Linoleic acid metabolism
• Nucleotide sugars metabolism
• Polyketide sugar unit biosynthesis
• Retinol metabolism
• Tetrachloroethene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-, 1.6.5.5

Use Curated BLAST to search for 1.1.1.- or 1.6.5.5

Sequence Analysis Tools

See Q2RYA2 at UniProt or InterPro

Protein Sequence (340 amino acids)

>Rru_A0088 Zinc-containing alcohol dehydrogenase superfamily (NCBI) (Rhodospirillum rubrum S1H)
MKAVGTHAPLPIDHPEALLDLEIDKPVPGPRDLLVRIEAISVNPVDTKTRKTRPASPENP
AILGWDAAGVVEAVGESVTLFKPGEAVYYAGDLTRPGTNAQFHLVDERLAALKPTSLDFA
EAAALPLTTITAYEMLFDRLGVPRSSPEALGEVRSILIVGGAGGVGSIAIQLARRLTGLT
VIATASRPETRDWVSAMGAHHVVDHRGDLAEQINALGVGPVGFIFSTTQTPSHFPALAKI
IAPQGRIGMIDDGVGLDFSLLKTKSASLHWEFMYTRSMFHTEDMIAQHSLLSEVAGLIDD
GTLRTTLTATDGPISAATLKAAHATQESGTTIGKRVLVGF