Protein Info for Rru_A0087 in Rhodospirillum rubrum S1H

Annotation: HI0933-like protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 PF03486: HI0933_like" amino acids 10 to 399 (390 residues), 245.4 bits, see alignment E=1.2e-76 TIGR00275: flavoprotein, HI0933 family" amino acids 11 to 399 (389 residues), 287.9 bits, see alignment E=1.1e-89 PF00890: FAD_binding_2" amino acids 11 to 62 (52 residues), 23 bits, see alignment 8.4e-09 PF13450: NAD_binding_8" amino acids 13 to 44 (32 residues), 24.7 bits, see alignment (E = 4.6e-09) TIGR03862: flavoprotein, TIGR03862 family" amino acids 31 to 405 (375 residues), 524.2 bits, see alignment E=1.7e-161 PF22780: HI0933_like_1st" amino acids 197 to 347 (151 residues), 86.2 bits, see alignment E=4.5e-28

Best Hits

KEGG orthology group: K07007, (no description) (inferred from 100% identity to rru:Rru_A0087)

Predicted SEED Role

"NAD(FAD)-utilizing dehydrogenases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RYA3 at UniProt or InterPro

Protein Sequence (413 amino acids)

>Rru_A0087 HI0933-like protein (NCBI) (Rhodospirillum rubrum S1H)
MAERGTAEGRVAVIGGGPAGLMAAERIAEAGFGVDVFDAMPSLGRKLLMAGRGGLNITHS
EPLERFLERYGAGRPRLEPMIRAFSPEALRGWLADLGQPTVVGSSGRVFPQAFKASPLLR
AWLRRLDGAGVAFHPRHRWLGWDADGALAFTGPTGRQRIQASATVLALGGASWPRLGSDG
AWVGVLEAKGIAVSALRPANCGFDIGWSAVLADRFAGAPLKPVVATFAGEHRRGECVLTR
TGVEGGLIYAFSAALREAIAGGGGATLILDLMPDHSPAALEAALARPRGGRSLATHLKRC
GVGAVQAALLREGAGPADLADPAAIARRLKALPLRLIAPRPLAEAISTAGGVAFAELSPS
LMLRALPGVFCCGEMLDWEAPTGGYLLTACLATGRAAGQGVARYLAADRVPAA