Protein Info for Rru_A0068 in Rhodospirillum rubrum S1H

Annotation: Alpha/beta hydrolase fold (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details PF12146: Hydrolase_4" amino acids 67 to 305 (239 residues), 195.2 bits, see alignment E=1.7e-61 PF00561: Abhydrolase_1" amino acids 72 to 186 (115 residues), 48.8 bits, see alignment E=1.2e-16 PF12697: Abhydrolase_6" amino acids 72 to 304 (233 residues), 42.5 bits, see alignment E=1.8e-14

Best Hits

KEGG orthology group: K01054, acylglycerol lipase [EC: 3.1.1.23] (inferred from 100% identity to rru:Rru_A0068)

Predicted SEED Role

"Lysophospholipase (EC 3.1.1.5)" in subsystem Triacylglycerol metabolism (EC 3.1.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.23 or 3.1.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RYC2 at UniProt or InterPro

Protein Sequence (375 amino acids)

>Rru_A0068 Alpha/beta hydrolase fold (NCBI) (Rhodospirillum rubrum S1H)
MSGNGGARGSRLGRAALVAGLLGLAACAPALAPSGPPDGLAAMTPLSFRARDGIVLPLRS
WEPAKGPVRAEILALHGFNDYSGAFETAGPALAARGIAVHAYDQRGFGTAPGRGLWPGGD
ILVRDAREAIATLHARHPERPLYVLGESMGGAIAITALTGPEAPRDLVAGLVLSAPAVWG
RDTMPWSYRAALWLASRVVPGLRLSGKGLKRYPSDNLPLLYRIAEDPLWIRATRTDAMRG
VVDIMDQAYARAGALGGPVLMLYGLNDQIIPAEPIREVARRLPGEPPLQRLAVYPEGWHL
LTRDLQAEVVLDDIAAWIANPAAPLPSRAEERAGAFLKGELTSMEEHDQRADPYRLWQAR
KPAPPPQDPTVTAPP