Protein Info for Rru_A0064 in Rhodospirillum rubrum S1H

Annotation: squalene-phytoene synthase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 687 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 188 to 204 (17 residues), see Phobius details amino acids 296 to 322 (27 residues), see Phobius details amino acids 324 to 343 (20 residues), see Phobius details amino acids 355 to 372 (18 residues), see Phobius details TIGR03469: hopene-associated glycosyltransferase HpnB" amino acids 11 to 392 (382 residues), 586.6 bits, see alignment E=2.2e-180 PF13506: Glyco_transf_21" amino acids 13 to 391 (379 residues), 31.7 bits, see alignment E=1.5e-11 PF13641: Glyco_tranf_2_3" amino acids 49 to 258 (210 residues), 44.9 bits, see alignment E=2.4e-15 PF00535: Glycos_transf_2" amino acids 54 to 234 (181 residues), 66.2 bits, see alignment E=7e-22 TIGR03465: squalene synthase HpnD" amino acids 417 to 686 (270 residues), 347.9 bits, see alignment E=3e-108 PF00494: SQS_PSY" amino acids 418 to 675 (258 residues), 223.8 bits, see alignment E=6.4e-70

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A0064)

Predicted SEED Role

"Phytoene synthase (EC 2.5.1.32)" in subsystem Carotenoids (EC 2.5.1.32)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.32

Use Curated BLAST to search for 2.5.1.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RYC6 at UniProt or InterPro

Protein Sequence (687 amino acids)

>Rru_A0064 squalene-phytoene synthase (NCBI) (Rhodospirillum rubrum S1H)
MIPPLQLSPLALVALLSLAAWAVVLLTRRRFWRCDQRLGQNTMAPGAAPAVVAVIPARDE
AHTIGQTVRSLLNQSYPGRLVVVVVDDSSSDGTADAARAGAASVYDGPSRLIVVPGKPLE
AGWSGKLWAVHQGLEVAAQAVPEARYVLLTDADIEHIPGNIARLVGKCERDGLVMASLMV
KLRCESAWEHLLIPAFIFFFQKLYPFPLVNDPDRRVAGAAGGCILARRETLDAIGGVAAV
RGALIDDCALAALLKEKGPIWLGLAGRTRSLRPNDELGDVWRMVARTAYVQLHHSPLRLI
GAVIGMTLLYLVPPVSLIVGILSADFPAAVAGLVGWIGLAIIYRPTLHLYRRPPMAGLAL
PLAALLYTLMTIDSARRHYVGRGGEWKGRTYSGDASAGADPGPRSPAELAAHVEAITKAS
GTSFYGAMRILPRERRLAMYAIYAFCRVVDDIADGTAPEAEKRAELARWRDEIEALYARG
GKGPEHPVARALDGPIRRFALPREDFLAVIEGMELDAGPRVRIRDITELEQYCDWVACAV
GRLSNRIFGADPALSDDVARHTGLALQLTNILRDVVEDAERDRLYLPLSRLRAHGLKTTK
DIDAVLVHPATAKVCAELASKAAAEFAEADRAQAACDRKTMRPAIIMKEVYRRIHAALMV
RGWARLGEPVKVSRLTKLGIALRHGWL