Protein Info for Rru_A0061 in Rhodospirillum rubrum S1H

Annotation: Purine and other phosphorylases, family 1 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03468: hopanoid-associated phosphorylase
  • amino acids 15 to 231 (217 residues), 252 bits, E=2.1e-79
• PF01048: PNP_UDP_1
  • amino acids 42 to 202 (161 residues), 100 bits, E=7.3e-33

Best Hits

KEGG orthology group: K01243, S-adenosylhomocysteine/5'-methylthioadenosine nucleosidase [EC: 3.2.2.9] (inferred from 100% identity to rru:Rru_A0061)

Predicted SEED Role

No annotation

MetaCyc Pathways

• S-methyl-5'-thioadenosine degradation IV (1/1 steps found)
• 5'-deoxyadenosine degradation II (3/4 steps found)
• S-adenosyl-L-methionine salvage I (3/4 steps found)
• autoinducer AI-2 biosynthesis II (Vibrio) (4/6 steps found)
• S-methyl-5'-thioadenosine degradation I (1/2 steps found)
• autoinducer AI-2 biosynthesis I (3/5 steps found)
• L-cysteine biosynthesis VI (reverse transsulfuration) (4/7 steps found)
• L-methionine salvage cycle I (bacteria and plants) (6/12 steps found)
• L-methionine salvage cycle II (plants) (4/11 steps found)

KEGG Metabolic Maps

• Methionine metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.2.9

Sequence Analysis Tools

See Q2RYC9 at UniProt or InterPro

Protein Sequence (242 amino acids)

>Rru_A0061 Purine and other phosphorylases, family 1 (NCBI) (Rhodospirillum rubrum S1H)
MTVEQMSSPTVPALRSVGLVTGLALEAALVPAKASPRLIPLCAGPGPAAAARASWRLMER
GCSVLVSFGTAGGLDPALPPGTLIIPEEIRLIGDQPPLPVDSTLRRRLLAACERAGLPVH
AGPLVGSDLPLLSPAEKARVAQLSGAAAVDMESHRVAEIALDAGLPFLAVRVIADPADRS
VPRWAMKGINEKGATVVAPILLALALAPWRLPALITLARSAARARHTLGRVACGPLLDLL
GR