Protein Info for Rru_A0043 in Rhodospirillum rubrum S1H
Annotation: UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase, LpxD (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K02536, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [EC: 2.3.1.-] (inferred from 100% identity to rru:Rru_A0043)Predicted SEED Role
"UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase (EC 2.3.1.-)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.-)
MetaCyc Pathways
- lipid IVA biosynthesis (E. coli) (5/6 steps found)
- superpathway of (Kdo)2-lipid A biosynthesis (9/17 steps found)
- superpathway of Kdo2-lipid A biosynthesis (9/25 steps found)
KEGG Metabolic Maps
- 1- and 2-Methylnaphthalene degradation
- Alkaloid biosynthesis I
- Alkaloid biosynthesis II
- Anthocyanin biosynthesis
- Benzoate degradation via CoA ligation
- Biosynthesis of terpenoids and steroids
- Biosynthesis of type II polyketide backbone
- Biosynthesis of unsaturated fatty acids
- Butanoate metabolism
- Carotenoid biosynthesis - General
- Diterpenoid biosynthesis
- Ether lipid metabolism
- Ethylbenzene degradation
- Fatty acid biosynthesis
- Glycerophospholipid metabolism
- Glycosphingolipid biosynthesis - ganglio series
- Histidine metabolism
- Limonene and pinene degradation
- Lipopolysaccharide biosynthesis
- Lysine degradation
- Phenylalanine metabolism
- Tyrosine metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.3.1.-
Use Curated BLAST to search for 2.3.1.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q2RYE7 at UniProt or InterPro
Protein Sequence (389 amino acids)
>Rru_A0043 UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase, LpxD (NCBI) (Rhodospirillum rubrum S1H) MPAVCPVLWREAVCRSSSIQMTQPLPMTLTQVAEALGGTLHGQGDLIIRRPVHPARAEAG EGVTDLAVAMEPALLAALEGSAARAALVAGGAVPPAGSVDGWIEVGRPRFAMHVITGRFE QPARLAPGIHPSAVVEEGAEIGEGAALGPFVHVGFGARVGAGSRVHSGVSIGAGAVVGAD CLLHPGVRIGERVRVGDRVILHANAVIGADGFSFVTPEPGSVESAKATGRVDAINSRLAR IASLGAVVLGDDVEIGANTCIDRGTLDDTRIGDGTKIDDMVMIGHNVRVGRLCMLCAQVG IAGSAVIGDGVVLAGRVGVADHITIGDNAVVGAGSGVGSNIPPRSVWMGYPALPKDQATE HYLFSRRLKHLFKDVSELKKRIRSLTVPS