Protein Info for Rru_A0017 in Rhodospirillum rubrum S1H

Annotation: Bacitracin resistance protein BacA (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 46 to 66 (21 residues), see Phobius details amino acids 87 to 110 (24 residues), see Phobius details amino acids 118 to 137 (20 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 191 to 213 (23 residues), see Phobius details amino acids 223 to 246 (24 residues), see Phobius details amino acids 254 to 274 (21 residues), see Phobius details PF02673: BacA" amino acids 7 to 264 (258 residues), 218 bits, see alignment E=9.1e-69

Best Hits

Swiss-Prot: 100% identical to UPPP1_RHORT: Undecaprenyl-diphosphatase 1 (uppP1) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K06153, undecaprenyl-diphosphatase [EC: 3.6.1.27] (inferred from 100% identity to rru:Rru_A0017)

Predicted SEED Role

"Undecaprenyl-diphosphatase (EC 3.6.1.27)" (EC 3.6.1.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.27

Use Curated BLAST to search for 3.6.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RYH3 at UniProt or InterPro

Protein Sequence (282 amino acids)

>Rru_A0017 Bacitracin resistance protein BacA (NCBI) (Rhodospirillum rubrum S1H)
MLLLQIVVLALIQGITEVLPLSSTGHLALLPLLTPWPSPTTWPDQGVALDVAVHLGTLGA
VALYFWRDEAAMIGGCLRLLKGKRDPGARLAFLVVLGTLPAVATVLLLAHFAGPIASPGL
ATIGWTTLGFGLLLGVIDRLCMTVKRVEHMGGIDCLLIGLAQCLALLPGVSRTGVAMTAA
RLLGYERVESARFSMLLSIPAIAGAATLVGLDLARVGQSAMAPAALIAAVTAFLAAFLAV
AAMMAWLRRHGFGPFVAYRVLLGAALLALAYLGPDLAPFLVS