Protein Info for Rru_A0010 in Rhodospirillum rubrum S1H

Annotation: Sigma-54 (RpoN) (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 PF00309: Sigma54_AID" amino acids 6 to 50 (45 residues), 69.9 bits, see alignment 1.9e-23 TIGR02395: RNA polymerase sigma-54 factor" amino acids 11 to 492 (482 residues), 430.6 bits, see alignment E=3.7e-133 PF04963: Sigma54_CBD" amino acids 133 to 320 (188 residues), 176.2 bits, see alignment E=9.2e-56 PF04552: Sigma54_DBD" amino acids 334 to 493 (160 residues), 220.8 bits, see alignment E=1.2e-69

Best Hits

Swiss-Prot: 53% identical to RP54_CAUVC: RNA polymerase sigma-54 factor (rpoN) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K03092, RNA polymerase sigma-54 factor (inferred from 100% identity to rru:Rru_A0010)

Predicted SEED Role

"RNA polymerase sigma-54 factor RpoN" in subsystem Flagellar motility or Flagellum or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RYI0 at UniProt or InterPro

Protein Sequence (500 amino acids)

>Rru_A0010 Sigma-54 (RpoN) (NCBI) (Rhodospirillum rubrum S1H)
MVMSPRLDLRQTQSLVMTPQLQQAIKLLQLSNMELSVYVDQELERNPLLERDDSADVSPE
PDRREERADSAETQVLDVVPGNTTDAPLDQDFNTAAEEGTPSDSWAEAGGGFDAGTPWGS
GTSGSFDDSDGGLEQMVAGPRSLRDHLSDQITLDLKTSADRLIAHHLMGMLDDAGYLIGA
LDEVADSLGCSLAEVERVLGRLQAMDPPGLFARSLKECLAIQLADLNRLDPAMQALLDHL
EMLGRRDIAGLLKICGVDHEDMMGMIAEIRALDPKPALRFENTLTQPVIPDVLMRPDPAG
GWLVELNSETLPRVLINNRYHARLSRSGDKETRTFLSENLATANWLVKSLDQRANTILKV
ATELVRQQDAFFLHGVRHLRPLILRDIAEAIEMHESTVSRVTSNKYIASPRGIFELKYFF
TQAIGAADGGESHSAEAVRDRIRSLIEAESPDQVLSDDKLVDILRTDGIDIARRTVAKYR
EGMRIASSVRRKKEKSGRLP