Protein Info for Rru_B0039 in Rhodospirillum rubrum S1H

Annotation: Type I secretion system ATPase, PrtD (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 585 transmembrane" amino acids 29 to 51 (23 residues), see Phobius details amino acids 65 to 83 (19 residues), see Phobius details amino acids 135 to 158 (24 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 257 to 272 (16 residues), see Phobius details TIGR01842: type I secretion system ATPase" amino acids 22 to 564 (543 residues), 738.1 bits, see alignment E=2.9e-226 PF00664: ABC_membrane" amino acids 33 to 288 (256 residues), 61.6 bits, see alignment E=1e-20 PF00005: ABC_tran" amino acids 355 to 502 (148 residues), 105.1 bits, see alignment E=4.8e-34

Best Hits

Swiss-Prot: 50% identical to APRD_PSEAE: Alkaline protease secretion ATP-binding protein AprD (aprD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 100% identity to rru:Rru_B0039)

Predicted SEED Role

"Type I secretion system ATPase, PrtD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RML0 at UniProt or InterPro

Protein Sequence (585 amino acids)

>Rru_B0039 Type I secretion system ATPase, PrtD (NCBI) (Rhodospirillum rubrum S1H)
MALVPKAKPQSQKVVTELQEALKKARGGFVSTMAFSFFINLLLFVSPLYMLQVYDRVLTS
RSNSTLVVLTLAAVGALIVLGLIEAVRSRILVRTGALIDTELNTRVFSSVFQQAVRRPAA
GYTQALRDLDTLREFLTGSGLIVFCDAPWAPLFIALGFVLHPLLGLVSLFGAIVVFALAI
VNNLGTRGLLKDAGTVSMHANNYVSSSLRNAEVLEAMGMMSNIQRRWSERHDAVIGLQAK
ASDRASAVMAASKSFRMGLQVAILGTGAYLAIHSEISPGTMIAASIIMGRALQPVEMAVG
QWKGLVAARGAYERLTDLLANNAAGKDTMTLPRPEGRVSLQQVVIVPPGSSVPALRGVTL
DIAPGEVLGVIGPSAAGKSTLARALVGVWPPVQGIVRLDGNDLRHWKSEEIGPHLGYLPQ
DVELFDGSVAENIARFGDIDPDKVIAAARKAGVHDMVQKLPEGYDTKIGVGGQALSGGQR
QRIALARAVYNDPVLVVLDEPNASLDADGEAALMVAIDGMRAAGQTVVVITHKPTLLNAV
DTVLVLKGGLVEMKGPRADVLSKFARPRAVASQDAPVQITATPGI