Protein Info for Rru_B0020 in Rhodospirillum rubrum S1H

Annotation: Major facilitator superfamily MFS_1 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 515 transmembrane" amino acids 27 to 50 (24 residues), see Phobius details amino acids 64 to 85 (22 residues), see Phobius details amino acids 96 to 119 (24 residues), see Phobius details amino acids 125 to 145 (21 residues), see Phobius details amino acids 154 to 176 (23 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 215 to 233 (19 residues), see Phobius details amino acids 245 to 263 (19 residues), see Phobius details amino acids 280 to 300 (21 residues), see Phobius details amino acids 312 to 331 (20 residues), see Phobius details amino acids 343 to 364 (22 residues), see Phobius details amino acids 371 to 397 (27 residues), see Phobius details amino acids 418 to 435 (18 residues), see Phobius details amino acids 485 to 507 (23 residues), see Phobius details PF07690: MFS_1" amino acids 35 to 423 (389 residues), 134.8 bits, see alignment E=3.5e-43 PF00083: Sugar_tr" amino acids 62 to 200 (139 residues), 29 bits, see alignment E=5.4e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_B0020)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RMM9 at UniProt or InterPro

Protein Sequence (515 amino acids)

>Rru_B0020 Major facilitator superfamily MFS_1 (NCBI) (Rhodospirillum rubrum S1H)
MSGVSTPRIPAADAPFASPDTPARRQAILAVMVGCAALVFGLGASLNLAVGRIATSPLHP
SATAVLWIVDTYLVVFGCLLIPAGAIGDRYGRKQAMLAGLTFLAVGSLLSAVAATVPVLL
AGRAVAGAGAALILPNSLALVVQVYPADQKSHAIAVWTGMTGLGGALGNILGGLVLQFAE
WQAIFTVAVPLALAGLALTAWLAPRQAGHEHPLDLVGAGILMLSIFALLTGLIEGQELGW
ASTEVIGALCAAAALLAVFLTTAARRKHPLVDPRIFRARGLCAGMLGITASFIAMYSLFY
LNGQYLMSVKGYPPALAGICTLPLVVVLFWLSPRSVQLARRFGARPVVAVGLAMLIVGLG
LLRLCGADTSYWFYAASIGVIGIGSALSNPVLSTAIIGALPPHQAGVGSGINSFTREIGG
ALGVALFGSLLGSSFPSRLPDTLAQAHGAVQRSVGAALAYAESLPGTAANQTVQVVRQAF
SGAMAQSLLTVMLVLAVAAVLAVLWYPASAGSAEK