Protein Info for DVUA0063.1 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: no description

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 PF02388: FemAB" amino acids 136 to 223 (88 residues), 24.8 bits, see alignment E=9.6e-10 amino acids 233 to 307 (75 residues), 33.9 bits, see alignment E=1.7e-12 PF13480: Acetyltransf_6" amino acids 162 to 289 (128 residues), 72.3 bits, see alignment E=4.8e-24

Best Hits

KEGG orthology group: None (inferred from 99% identity to dvl:Dvul_3045)

Predicted SEED Role

"FIG00604587: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (335 amino acids)

>DVUA0063.1 no description (Desulfovibrio vulgaris Hildenborough JW710)
MTGHALHIAPCGPSRHAEWDAFVEAHPARPLFHSRRWLSLLARHQGVRLDLHCIEAQGRV
VGLLPMFSRGYGVIRVHSSPYVVTDTPYLGPLVDDDVSPHALWAALLDHARHSGMDFVRL
FTRVGMACPPVDGTPAGVQRKTTHVLDLTPGEEALWNGLEGRCRTAVRKAAKEGVTVEPM
ADDAALERFVDMLEGVYARQGLTSPNPRAFYRDVWRTFGGREVVGLTARHEGRDIASALF
VMDARDAYYISGASAGDCGRLSPNNILQWEAIRLALARGVVRYDFVGSDIPRIARFKASF
GGQLHEYWCVECAPSRVARFMRAAYPWLKRRLGRV