Protein Info for DVUA0020.1 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: no description

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 transmembrane" amino acids 199 to 220 (22 residues), see Phobius details amino acids 231 to 251 (21 residues), see Phobius details amino acids 263 to 281 (19 residues), see Phobius details amino acids 307 to 327 (21 residues), see Phobius details amino acids 348 to 377 (30 residues), see Phobius details amino acids 385 to 412 (28 residues), see Phobius details TIGR03008: CAAX prenyl protease-related protein" amino acids 192 to 414 (223 residues), 316.7 bits, see alignment E=5e-99 PF02517: Rce1-like" amino acids 308 to 399 (92 residues), 49.6 bits, see alignment E=2e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVUA204)

Predicted SEED Role

"FIG00604339: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (414 amino acids)

>DVUA0020.1 no description (Desulfovibrio vulgaris Hildenborough JW710)
MKTPPTAHPEVHPDARSDAHPETSPDTSPDSLADTAPGTASPDTGHATPWGTSPETASPD
AHPDTNRVTSPYTAPGTAPGTPPGSSPDTSPDAPANTPRNTPGNAESMASAARPGSAPHA
DAPVSGDAAPGSARHPVGTGVTEEAPPDPAHDPAPDPDRPSGPGEPAGLANTAGADTTTG
AGKATSAPVAAIAWRVAPFAAYMAFVLVVEAASMLGISSTTLATYGDFAGGLYPVKALCV
GLVLAVCLPRCTELRFAKADLRGLPFAIVVGVAVFAAWLALDVPWARMGEPAPFAHEAWG
DAGRPALLTIRFIGATLLVPLAEELFWRSFLLRHLQGGDFRTVPLTRFHATSFIAVTILF
GLEHNLIVAGMAAGAAYNLVALRTGSVMCCVVAHAVTNGLLGLWVVATGAWTLW