Protein Info for DVU3304 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: no description

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 492 transmembrane" amino acids 15 to 39 (25 residues), see Phobius details amino acids 183 to 202 (20 residues), see Phobius details PF00512: HisKA" amino acids 268 to 330 (63 residues), 43.3 bits, see alignment E=3.2e-15 PF02518: HATPase_c" amino acids 374 to 481 (108 residues), 95 bits, see alignment E=4e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_0091)

Predicted SEED Role

"integral membrane sensor signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (492 amino acids)

>DVU3304 no description (Desulfovibrio vulgaris Hildenborough JW710)
MRPPLFGTLRANLRQLVMAGIALSILGISVLGGMSYSYLLQLDDALGLAEVVDDLSSDIL
EIRRYEKNYLLYVMEEDYTENLAFIERALGVTNVILPPDGTGMLGTDEQGRHAIVALRQQ
LHGYRATITRLEQLRRQGDNRQADSLLNDLREEGKRLVEGARQIAAYQRSRILGMVSKLK
QQLLISILGFLAVAVFFSWLVGRRLLGAFTLIENATRGIVQGDFKPLPLPDSRDESRSVV
KALNHMIEELENRQNQLVQEKKLASLGVLTSGIAHQLNNPLNNISTSCQILQEDIGSGDA
ELHARMLRNIHQEVLRSRDIVKGLLEFAREKDFSLVPQRLADVVERAVSLVSSEVPAGVT
LSASVPPDMVVPLDAQHMQEALINLLINAIQAIPAPPGTITVSATRVPGRDMVALRVEDT
GTGIPPEHLGRIFDPFFTLKAVGKGTGLGLSIVFGVVKKHGGRVTVESEPGKGTAFIIHL
HDNDAAGRGMHT