Pairwise Alignments
Query, 118 a.a., hypothetical protein from Pseudomonas simiae WCS417
Subject, 243 a.a., transcriptional activator of csgD and csgBA from Escherichia coli BL21
Score = 48.1 bits (113), Expect = 7e-11 Identities = 23/71 (32%), Positives = 39/71 (54%), Gaps = 1/71 (1%) Query: 19 FTIGEVSELCAVKPHVLRYWEQEFPQLNPVKRTGNRRYYQRQDVLMIRQIRALLYDQGFT 78 +TIGEV+ LC + P LR W++ + L P + G R + D+ IR+I+ + D G Sbjct: 4 YTIGEVALLCDINPVTLRAWQRRYGLLKPQRTDGGHRLFNDADIDRIREIKRWI-DNGVQ 62 Query: 79 ISGARQRMSGD 89 +S + +S + Sbjct: 63 VSKVKMLLSNE 73