Pairwise Alignments
Query, 115 a.a., histidine kinase dimerization/phospho-acceptor domain-containing protein from Paraburkholderia sabiae LMG 24235
Subject, 949 a.a., hybrid sensory kinase in two-component regulatory system with RcsB and YojN from Escherichia coli BL21
Score = 42.4 bits (98), Expect = 1e-08 Identities = 25/59 (42%), Positives = 35/59 (59%), Gaps = 7/59 (11%) Query: 44 VMVGALADVTSRVSAEAALRE-------ADRRKDVFLATLAHELRNPLAPILNAAHLLR 95 V + L DV+SRV E +L+E A + K +FLAT++HELR PL I+ LL+ Sbjct: 438 VAICVLVDVSSRVKMEESLQEMAQAAEQASQSKSMFLATVSHELRTPLYGIIGNLDLLQ 496