Pairwise Alignments
Query, 712 a.a., Predicted ATP-dependent endonuclease of the OLD family from Enterobacter asburiae PDN3
Subject, 368 a.a., recF protein from Echinicola vietnamensis KMM 6221, DSM 17526
Score = 43.1 bits (100), Expect = 2e-08 Identities = 18/46 (39%), Positives = 29/46 (63%) Query: 1 MHISKLTLVNYRNFKNTSLQFHKGVNTVIGENGSGKSNILRAIRLL 46 MH+ L L+ ++N++ + F +N +G NGSGK+N+L AI L Sbjct: 1 MHLKSLQLIQFKNYEKALVAFSPEINCFLGINGSGKTNMLDAIHYL 46