Protein Info for UW163_RS18335 in Ralstonia solanacearum UW163

Annotation: 4-hydroxyphenylpyruvate dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF14696: Glyoxalase_5
  • amino acids 4 to 122 (119 residues), 76.9 bits, E=2.8e-25
• TIGR01263: 4-hydroxyphenylpyruvate dioxygenase
  • amino acids 8 to 342 (335 residues), 283.6 bits, E=1.5e-88
• PF00903: Glyoxalase
  • amino acids 148 to 265 (118 residues), 33 bits, E=1.1e-11
• PF13669: Glyoxalase_4
  • amino acids 159 to 260 (102 residues), 28.4 bits, E=2.6e-10

Best Hits

KEGG orthology group: K00457, 4-hydroxyphenylpyruvate dioxygenase [EC: 1.13.11.27] (inferred from 93% identity to rsl:RPSI07_1325)

Predicted SEED Role

"4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27)" in subsystem Aromatic amino acid degradation or Homogentisate pathway of aromatic compound degradation or Plastoquinone Biosynthesis or Tocopherol Biosynthesis (EC 1.13.11.27)

MetaCyc Pathways

• L-tyrosine degradation I (5/5 steps found)
• plastoquinol-9 biosynthesis I (1/3 steps found)
• L-phenylalanine degradation IV (mammalian, via side chain) (5/9 steps found)
• superpathway of plastoquinol biosynthesis (2/5 steps found)
• vitamin E biosynthesis (tocopherols) (1/7 steps found)

KEGG Metabolic Maps

• Phenylalanine metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.13.11.27

Use Curated BLAST to search for 1.13.11.27

Protein Sequence (346 amino acids)

>UW163_RS18335 4-hydroxyphenylpyruvate dioxygenase (Ralstonia solanacearum UW163)
MSAVTTAGFAFVEFVCPELAGLVALFGKLGFKPLGQHAQTGAVLLRQNEAALIVNPEPNP
FRDIHGASARAIAIHVDNAANALAQALEGGARRATPAEFGAFVADAPAIAGIGDSLVYFV
DHDIESAFSTPYRPAQPAGVADAAIQAIDHTSNIVKPENLDHWADFYRDTFAFVQKQYLD
VKGRQTGMRARSMVSPCGKVSIPIAAAAHDQPGVLNQNEEFIRDYRGEGIQHIAFLSSNI
EQTIAAMEAAGIDFMDAPPQTYYRNLDARVPGHGQNLDSVERRGILVDGKGDGRILLQRF
TRRQIGPIFFEIIERRGEDGFGEGNFKALFESQEQDQVRRGSLNAS