Protein Info for UW163_RS16695 in Ralstonia solanacearum UW163

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF19335: HMBD" amino acids 61 to 88 (28 residues), 33.6 bits, see alignment (E = 9e-12) PF16576: HlyD_D23" amino acids 122 to 331 (210 residues), 239.1 bits, see alignment E=1e-74 PF16572: HlyD_D4" amino acids 167 to 222 (56 residues), 49.7 bits, see alignment 7.8e-17 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 206 to 405 (200 residues), 125.5 bits, see alignment E=1.1e-40 PF13437: HlyD_3" amino acids 229 to 328 (100 residues), 67.4 bits, see alignment E=4.9e-22 PF11604: CusF_Ec" amino acids 437 to 502 (66 residues), 71.7 bits, see alignment E=1.2e-23

Best Hits

KEGG orthology group: K07798, Cu(I)/Ag(I) efflux system membrane protein CusB (inferred from 88% identity to rso:RS05406)

Predicted SEED Role

"Cobalt/zinc/cadmium efflux RND transporter, membrane fusion protein, CzcB family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (511 amino acids)

>UW163_RS16695 efflux RND transporter periplasmic adaptor subunit (Ralstonia solanacearum UW163)
MNKTLIATVAGVLLIGAAAYGGYRIGLSHGTRSTQADASASNPTGLKAGDIDPQTGKRVL
YWHDPMVPGQRFDKPGKSPFMDMQLVPVYADGDAGGSGVAIDSRVAQNLGIRTAEAQMGR
LGTVLEAPGNVAVDERSVQVIQARTSAFVQQVSVRATLDPVRRGQTLVSLYSPDWVAAQE
EYLAVSRQAAHGQSNLAGAAEARMLQAGMTPGQISAVAASGKLQPALAIISPIDGVVTEV
AVRDGMTVTPGMTLFRLADLSRVWVIAEVPEAQIRSVAPGAPVKVSAAGLTEPATGKVDA
ILPDVNAATRTIKVRIVLPNQDKRLVPGIFATVRFDGSQDKAALLIPSEAVIRTGQRSIV
MVGSGQAGFVPTEIRTGREADGRVEVLQGLQAGQKVVTSGQFLIDSEASLRGTSERITVP
SAAAAPAAAITEHEGTGRIEAVTGDGLTLSHGPIPSLHWGAMTMDFAAPPTGLPKGLKPG
DRVRFRFHLDKDGTAVLSSVEPAANGAGGKP