Protein Info for UW163_RS14120 in Ralstonia solanacearum UW163

Annotation: benzoate 1,2-dioxygenase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13577: SnoaL_4
  • amino acids 5 to 132 (128 residues), 32.9 bits, E=5.7e-12
• TIGR03232: benzoate 1,2-dioxygenase, small subunit
  • amino acids 9 to 163 (155 residues), 289.6 bits, E=2.7e-91
• PF00866: Ring_hydroxyl_B
  • amino acids 15 to 155 (141 residues), 162.4 bits, E=7.7e-52

Best Hits

Swiss-Prot: 72% identical to BENB_ACIAD: Benzoate 1,2-dioxygenase subunit beta (benB) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K05550, benzoate 1,2-dioxygenase beta subunit [EC: 1.14.12.10] (inferred from 98% identity to rsc:RCFBP_11861)

MetaCyc: 61% identical to XylY (Pseudomonas putida mt-2)
Benzoate 1,2-dioxygenase. [EC: 1.14.12.10]

Predicted SEED Role

"Benzoate 1,2-dioxygenase beta subunit (EC 1.14.12.10)" in subsystem Benzoate degradation (EC 1.14.12.10)

MetaCyc Pathways

• benzoate degradation I (aerobic) (2/2 steps found)
• mandelate degradation to acetyl-CoA (9/18 steps found)
• meta cleavage pathway of aromatic compounds (2/10 steps found)
• toluene degradation IV (aerobic) (via catechol) (3/13 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (17/35 steps found)
• superpathway of aerobic toluene degradation (10/30 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (11/42 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Fluorobenzoate degradation

Isozymes

Compare fitness of predicted isozymes for: 1.14.12.10

Use Curated BLAST to search for 1.14.12.10

Protein Sequence (163 amino acids)

>UW163_RS14120 benzoate 1,2-dioxygenase small subunit (Ralstonia solanacearum UW163)
MSTIDMERIRAFLYREGRLLDDEQWDDWLACYHPDAEFWMPAWDDDDTLVTDPQREISLI
YYPNRQGLEDRIFRIKTERSSATAPDTRTSHNVSNIEMEQCDGDTVTVRFNWHTLSHRYQ
ANHSHFGMARYVIDFSGAQPLIRNKYVVLKNDYIHQVIDIYHV