Protein Info for UW163_RS08225 in Ralstonia solanacearum UW163

Annotation: histidine utilization repressor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 TIGR02018: histidine utilization repressor" amino acids 10 to 237 (228 residues), 325.7 bits, see alignment E=6.8e-102 PF00392: GntR" amino acids 13 to 74 (62 residues), 73.2 bits, see alignment E=1.6e-24 PF07702: UTRA" amino acids 95 to 232 (138 residues), 113.6 bits, see alignment E=1e-36

Best Hits

Swiss-Prot: 46% identical to HUTC_KLEAE: Histidine utilization repressor (hutC) from Klebsiella aerogenes

KEGG orthology group: K05836, GntR family transcriptional regulator, histidine utilization repressor (inferred from 99% identity to rsc:RCFBP_10799)

Predicted SEED Role

"Histidine utilization repressor" in subsystem Histidine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (237 amino acids)

>UW163_RS08225 histidine utilization repressor (Ralstonia solanacearum UW163)
MPPRQSAPAPAFQRIKEDILSRIRSGEWQEGEMIPGETSLAQTFSVSRMTVNRALRELTA
EQILTRVQGSGTFVAQQKYQATLVAIRNIAEEIAARGHRHRAELHRLERVRATEGMAAPF
GLAVGRTLFHSLIVHFENDLPIQVEDRWVNAELAPDYMEQDFTQTTPNAYLMRAAPLQGV
EYRIEARLPPREIAEMLHMDVREACLMLRRKTLSQGQVASVATMWHPGGRYQFTGSF