Protein Info for UW163_RS01675 in Ralstonia solanacearum UW163

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 57 to 82 (26 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 166 to 185 (20 residues), see Phobius details amino acids 190 to 207 (18 residues), see Phobius details amino acids 214 to 231 (18 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details amino acids 269 to 289 (21 residues), see Phobius details amino acids 310 to 329 (20 residues), see Phobius details amino acids 342 to 367 (26 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 11 to 355 (345 residues), 104 bits, see alignment E=4.4e-34

Best Hits

KEGG orthology group: None (inferred from 60% identity to rso:RSc1540)

Predicted SEED Role

"acyltransferase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (389 amino acids)

>UW163_RS01675 acyltransferase (Ralstonia solanacearum UW163)
MNRPTSDGFVARLEALRGIAALAVALFHAFIWIAFGEQRALFTKPVMDVHGLQATSARMI
IAIFCGPAAVNVFFVLSGFVLARSLRKTSPSIAMYARYIVKRVFRIFPALMLSIGLALLY
RAMLYPGYEAFPITSIWFNWWYKDPVTFQEAASNVLMLSASLNSNAWTLRIEMLASLILP
FVVGILGKSGWLRTALILIASLIWAVVTNNQETAPGELAHYAYMFVLGAVLEKHIRQIPR
VPLPLAAALWLLSIGTVIFVNAYWQLAHFLSTDAAIAVCAAIWIWLIVADSESRYLACLD
SRVVRYLGRLSYSFYILHFVFFYAIANWTLRGVSEHVLARYPIVAAGAVGLISIVVTLPV
ASLSYRFVEKPMIETGKRLASLRERLRTA