Protein Info for RPSI07_RS23295 in Ralstonia solanacearum PSI07

Annotation: orotate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 97% identical to PYRE_RALSO: Orotate phosphoribosyltransferase (pyrE) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K00762, orotate phosphoribosyltransferase [EC: 2.4.2.10] (inferred from 100% identity to rsl:RPSI07_3242)

MetaCyc: 54% identical to orotate phosphoribosyltransferase (Escherichia coli K-12 substr. MG1655)
Orotate phosphoribosyltransferase. [EC: 2.4.2.10]

Predicted SEED Role

"Orotate phosphoribosyltransferase (EC 2.4.2.10)" in subsystem De Novo Pyrimidine Synthesis (EC 2.4.2.10)

MetaCyc Pathways

superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
superpathway of pyrimidine ribonucleotides de novo biosynthesis (9/9 steps found)
UMP biosynthesis I (6/6 steps found)
UMP biosynthesis II (6/6 steps found)
UMP biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (226 amino acids)

>RPSI07_RS23295 orotate phosphoribosyltransferase (Ralstonia solanacearum PSI07)
MSQNSELRQSFIRFAVQAGVLSFGEFVTKAGRTSPYFFNAGKFSDGALLGQVAQFYAKTL
LDSGVQFDMLFGPAYKGITLASATAVALAGMGRNVGFAYNRKEAKDHGEGGSLVGAKLGG
RVVIVDDVISAGTSVRESVELIRNAGATPAAVLILMDRMERSGNAVDIGERSAVQEVQAQ
YGIPVVSIANLDDLLGYLDNAGDPALAGYRAKAAAYREKYGVSAVV