Protein Info for RPSI07_RS20980 in Ralstonia solanacearum PSI07

Annotation: paraquat-inducible protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 transmembrane" amino acids 90 to 111 (22 residues), see Phobius details amino acids 139 to 164 (26 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details amino acids 215 to 235 (21 residues), see Phobius details PF04403: PqiA" amino acids 92 to 241 (150 residues), 134.7 bits, see alignment E=1.3e-43

Best Hits

KEGG orthology group: K03808, paraquat-inducible protein A (inferred from 89% identity to rso:RSc0603)

Predicted SEED Role

"Paraquat-inducible protein A" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (274 amino acids)

>RPSI07_RS20980 paraquat-inducible protein A (Ralstonia solanacearum PSI07)
MEWFDVRLPFPLPKSWRAALSGAVPGIASGAPSDVPTAPVAEPLPGDPDAWIACEHCDTL
HRHEVIALDEEARCTRCGVKLYRNQTERLSVLLPLVVTGLIVYIVANVFPIAEMDGGGNR
NATTLWNTVEALYNYDMPLAAILVALTTVLFPLMYLTVLAPLLIARARGRQHPSAALALR
AAALIRPWAMIEIFMLGAVVALIKVAHMVSLEADIGLWAFAALTVFMTIALSIDLRPFWR
ELGLTRPPDVRMDAPAGPDAAAHPGEDTNGEARP