Protein Info for RPSI07_RS20615 in Ralstonia solanacearum PSI07

Annotation: dTDP-glucose 4,6-dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 PF04321: RmlD_sub_bind" amino acids 3 to 179 (177 residues), 48.5 bits, see alignment E=2e-16 TIGR01181: dTDP-glucose 4,6-dehydratase" amino acids 4 to 338 (335 residues), 513.5 bits, see alignment E=1e-158 PF02719: Polysacc_synt_2" amino acids 4 to 114 (111 residues), 41.3 bits, see alignment E=3.3e-14 PF01370: Epimerase" amino acids 4 to 253 (250 residues), 228.2 bits, see alignment E=3.1e-71 PF16363: GDP_Man_Dehyd" amino acids 5 to 325 (321 residues), 316.8 bits, see alignment E=6.7e-98 PF01073: 3Beta_HSD" amino acids 5 to 242 (238 residues), 42.7 bits, see alignment E=1.1e-14 PF07993: NAD_binding_4" amino acids 78 to 189 (112 residues), 24.5 bits, see alignment E=4.3e-09

Best Hits

Swiss-Prot: 65% identical to RMLB_NEIMB: dTDP-glucose 4,6-dehydratase (rfbB1) from Neisseria meningitidis serogroup B (strain MC58)

KEGG orthology group: K01710, dTDP-glucose 4,6-dehydratase [EC: 4.2.1.46] (inferred from 100% identity to rsl:RPSI07_2669)

MetaCyc: 64% identical to dTDP-glucose 4,6-dehydratase 1 (Escherichia coli K-12 substr. MG1655)
dTDP-glucose 4,6-dehydratase. [EC: 4.2.1.46]

Predicted SEED Role

"dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 4.2.1.46)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.46

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (354 amino acids)

>RPSI07_RS20615 dTDP-glucose 4,6-dehydratase (Ralstonia solanacearum PSI07)
MSHILVTGGAGFIGGNFVLNWLANPGTDSIVNVDKLTYAGNRKTLAAVERDPRHVFSQTD
ICDRAALDSLFAQYKPRAVVHFAAESHVDRSIHGPAEFIQTNIVGTFTLLEAVRAYWGGL
DADAKAAFRFLHVSTDEVFGSLSSTDPQFSETTPYAPNSPYSASKAASDHLVRAYHHTYG
LPVLTTNCSNNYGPYHFPEKLIPLMITNALSGKPLPVYGDGQNVRDWLYVGDHCAAIREV
LARGRLGETYNVGGWNEKTNLDVVHTLCDLLDELKPKATGSYRDQIAFVKDRPGHDRRYA
IDARKLERELGWKPAETFETGLRKTVQWYLDNQVWVQDVVSGEYRNWVAKQYAA