Protein Info for RPSI07_RS20300 in Ralstonia solanacearum PSI07

Annotation: Tol-Pal system beta propeller repeat protein TolB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details TIGR02800: Tol-Pal system beta propeller repeat protein TolB" amino acids 23 to 429 (407 residues), 518.1 bits, see alignment E=8.9e-160 PF04052: TolB_N" amino acids 32 to 130 (99 residues), 85.9 bits, see alignment E=4e-28 PF07676: PD40" amino acids 195 to 227 (33 residues), 31.3 bits, see alignment (E = 3.1e-11) amino acids 237 to 270 (34 residues), 38.6 bits, see alignment 1.6e-13 amino acids 279 to 315 (37 residues), 58.1 bits, see alignment 1.2e-19 amino acids 327 to 362 (36 residues), 31.8 bits, see alignment 2.1e-11 amino acids 376 to 400 (25 residues), 12.3 bits, see alignment (E = 2.8e-05)

Best Hits

Swiss-Prot: 96% identical to TOLB_RALSO: Tol-Pal system protein TolB (tolB) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03641, TolB protein (inferred from 100% identity to rsl:RPSI07_2603)

Predicted SEED Role

"tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (433 amino acids)

>RPSI07_RS20300 Tol-Pal system beta propeller repeat protein TolB (Ralstonia solanacearum PSI07)
MMMRNFWKSGLRRSAWIGLLMVLCAGVARAQLYVEIAGAGSSQYPIAIANFQGESQISQN
MTAIIRSDLVHSGRFSNVDVAGAVVPDSPAPDLGAWKSRGAAAFVGGTVTRNGDRYEIRF
RLYDTAKGESLGGLALTRGEGQLRLAAHEIADYIYQKLIGDRGVFATRLSYVSKVGRRYQ
LQISDSDGANPQIALTSNEPIISPSWSPDGTKVAYVSFESRKPVVYVHDLVAGRRTVISN
QKGNNSAPAWSPDGRRVAVALSRDGNTQIYLVNADGSGLRRLTRSSAIDTEPSFSPDGRS
IYFTSDRGGAPQIYRMPVEGEDAGSAQRVTFKGSYNTSPRMSPDGKLLAYISRVGGAFKL
YVQDLSNGDVTGLTDTAYDESPSFAANGKFILYATRVGGRSVLAAVSTDGRTRQILSLQA
GEVREPAWGPFMQ