Protein Info for RPSI07_RS18845 in Ralstonia solanacearum PSI07

Annotation: FAA hydrolase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01557: FAA_hydrolase
  • amino acids 26 to 231 (206 residues), 213.5 bits, E=1.5e-67

Best Hits

Swiss-Prot: 41% identical to FAHD1_HUMAN: Acylpyruvase FAHD1, mitochondrial (FAHD1) from Homo sapiens

KEGG orthology group: None (inferred from 100% identity to rsl:RPSI07_2305)

MetaCyc: 57% identical to 3-fumarylpyruvate hydrolase (Bradyrhizobium sp. JS329)
RXN-10445 [EC: 3.7.1.20]

Predicted SEED Role

"Fumarylacetoacetase (EC 3.7.1.2)" in subsystem Homogentisate pathway of aromatic compound degradation or Salicylate and gentisate catabolism (EC 3.7.1.2)

MetaCyc Pathways

• L-tyrosine degradation I (5/5 steps found)
• gentisate degradation I (3/3 steps found)
• 3-phenylpropanoate degradation (6/10 steps found)
• 5-nitroanthranilate degradation (3/6 steps found)

KEGG Metabolic Maps

• Styrene degradation
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.7.1.2

Use Curated BLAST to search for 3.7.1.2 or 3.7.1.20

Protein Sequence (232 amino acids)

>RPSI07_RS18845 FAA hydrolase family protein (Ralstonia solanacearum PSI07)
MTYVFTPPALTAIPVAGSSEQFAVRRVYCVGRNYAAHAREMGFDPDREPPFFFCKPADAI
VPVADGQTLALPYPTQTQNYHYEAELVAVIGKSGADIAVEDALDHVWGYAVGLDMTRRDL
QMKMREMGRPWEIGKAFDVSAPVGPIHRASDIGHPRQAGIWLTVNGEAKQRSDVSHLIWS
VAETVACLSQFFRLEPGDVIFTGTPEGVGAVKPGDAIVTGVDGLGELKVHIA