Protein Info for RPSI07_RS16975 in Ralstonia solanacearum PSI07

Annotation: IMP dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 487 TIGR01302: inosine-5'-monophosphate dehydrogenase" amino acids 7 to 455 (449 residues), 632.5 bits, see alignment E=2.1e-194 PF00478: IMPDH" amino acids 7 to 473 (467 residues), 551.9 bits, see alignment E=1.1e-169 PF00571: CBS" amino acids 94 to 138 (45 residues), 39.5 bits, see alignment 1.2e-13 amino acids 156 to 202 (47 residues), 41.2 bits, see alignment 3.3e-14 PF03060: NMO" amino acids 214 to 373 (160 residues), 39 bits, see alignment E=1.3e-13 PF01070: FMN_dh" amino acids 257 to 363 (107 residues), 35.8 bits, see alignment E=1e-12

Best Hits

Swiss-Prot: 64% identical to IMDH_ACICA: Inosine-5'-monophosphate dehydrogenase (guaB) from Acinetobacter calcoaceticus

KEGG orthology group: K00088, IMP dehydrogenase [EC: 1.1.1.205] (inferred from 99% identity to rsc:RCFBP_20004)

MetaCyc: 61% identical to inosine 5'-monophosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
IMP dehydrogenase. [EC: 1.1.1.205]

Predicted SEED Role

"Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205)" in subsystem Purine conversions (EC 1.1.1.205)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.205

Use Curated BLAST to search for 1.1.1.205

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (487 amino acids)

>RPSI07_RS16975 IMP dehydrogenase (Ralstonia solanacearum PSI07)
MRLVQKALTFDDVLLVPAYSAVLPRDTSLRTKLTRSIELAIPLVSAAMDTVTEARLAIAM
AQQGGIGIVHKNLKPEEQAREVAKVKRFESGVLRDPITIGPDMKVRDVMALSAQHGISGF
PVLEGNKVVGIITNRDLRFEEELDAPVRAKMTPGEKLVTVKEGASLEEAKRLMNKHRLER
VLVVDGNFELRGLITVKDIQKATEHPLASKDERGSLRVGAAVGVGPDNDLRVELLVKAGV
DVIVVDTAHGHSQGVLNRVRWIKDRYPQVQVIGGNIATAEAAKALVDHGADGVKVGIGPG
SICTTRIVAGVGVPQISAVSNVAEALKNTGVPLVADGGVRYSGDIAKALAAGAHTVMMGG
MFAGTEEAPGEVFLYQGRSYKSYRGMGSVGAMKDGAADRYFQEDNTANVDKLVPEGIEGR
VPYKGSVLPIVHQLTGGIRSSMGYCGCASVAEWHEKSQFVQITAAGMRESHVHDVQITKE
APNYHLD