Protein Info for RPSI07_RS16975 in Ralstonia solanacearum PSI07

Annotation: IMP dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01302: inosine-5'-monophosphate dehydrogenase
  • amino acids 7 to 455 (449 residues), 632.5 bits, E=2.1e-194
• PF00478: IMPDH
  • amino acids 7 to 473 (467 residues), 551.9 bits, E=1.1e-169
• PF00571: CBS
  • amino acids 94 to 138 (45 residues), 39.5 bits, 1.2e-13
  • amino acids 156 to 202 (47 residues), 41.2 bits, 3.3e-14
• PF03060: NMO
  • amino acids 214 to 373 (160 residues), 39 bits, E=1.3e-13
• PF01070: FMN_dh
  • amino acids 257 to 363 (107 residues), 35.8 bits, E=1e-12

Best Hits

Swiss-Prot: 64% identical to IMDH_ACICA: Inosine-5'-monophosphate dehydrogenase (guaB) from Acinetobacter calcoaceticus

KEGG orthology group: K00088, IMP dehydrogenase [EC: 1.1.1.205] (inferred from 99% identity to rsc:RCFBP_20004)

MetaCyc: 61% identical to inosine 5'-monophosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
IMP dehydrogenase. [EC: 1.1.1.205]

Predicted SEED Role

"Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205)" in subsystem Purine conversions (EC 1.1.1.205)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• superpathway of purine nucleotide salvage (12/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• purine nucleotides degradation I (plants) (10/12 steps found)
• adenosine nucleotides degradation I (7/8 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• superpathway of purines degradation in plants (14/18 steps found)
• inosine 5'-phosphate degradation (3/4 steps found)
• purine nucleotides degradation II (aerobic) (8/11 steps found)
• ureide biosynthesis (5/7 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.205

Use Curated BLAST to search for 1.1.1.205

Protein Sequence (487 amino acids)

>RPSI07_RS16975 IMP dehydrogenase (Ralstonia solanacearum PSI07)
MRLVQKALTFDDVLLVPAYSAVLPRDTSLRTKLTRSIELAIPLVSAAMDTVTEARLAIAM
AQQGGIGIVHKNLKPEEQAREVAKVKRFESGVLRDPITIGPDMKVRDVMALSAQHGISGF
PVLEGNKVVGIITNRDLRFEEELDAPVRAKMTPGEKLVTVKEGASLEEAKRLMNKHRLER
VLVVDGNFELRGLITVKDIQKATEHPLASKDERGSLRVGAAVGVGPDNDLRVELLVKAGV
DVIVVDTAHGHSQGVLNRVRWIKDRYPQVQVIGGNIATAEAAKALVDHGADGVKVGIGPG
SICTTRIVAGVGVPQISAVSNVAEALKNTGVPLVADGGVRYSGDIAKALAAGAHTVMMGG
MFAGTEEAPGEVFLYQGRSYKSYRGMGSVGAMKDGAADRYFQEDNTANVDKLVPEGIEGR
VPYKGSVLPIVHQLTGGIRSSMGYCGCASVAEWHEKSQFVQITAAGMRESHVHDVQITKE
APNYHLD