Protein Info for RPSI07_RS15015 in Ralstonia solanacearum PSI07

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 transmembrane" amino acids 38 to 59 (22 residues), see Phobius details amino acids 111 to 137 (27 residues), see Phobius details amino acids 149 to 168 (20 residues), see Phobius details amino acids 174 to 191 (18 residues), see Phobius details amino acids 238 to 239 (2 residues), see Phobius details amino acids 246 to 266 (21 residues), see Phobius details amino acids 278 to 299 (22 residues), see Phobius details PF12911: OppC_N" amino acids 24 to 79 (56 residues), 45.4 bits, see alignment E=5.7e-16 PF00528: BPD_transp_1" amino acids 127 to 309 (183 residues), 119.5 bits, see alignment E=1.5e-38

Best Hits

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 100% identity to rsl:RPSI07_1510)

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (312 amino acids)

>RPSI07_RS15015 ABC transporter permease (Ralstonia solanacearum PSI07)
MNTTSQTTAPAAQATAGPAPRRQSPWRRVAADFVASKSAVFGLAVVVLLVAAALVAPWIT
PQNPYDLMQLDVLDARLAPGSPNGAGTFTYWLGTDGQGRDLYSGILYGLRISLGVGIGSA
AVAAVIGTLLGLIAAYAGGKVDSLIMRTVDLLLSFPSVLVAMMILAYLGKSITNVVMTLV
LLEWAYYARTVRGQALVERRREYVEAARSLALPGWRIAARHILPNCLPPLIVVGTLQVAR
AITLEATLSFLGLGVPITEPSLGLLIANGYQYMLSGQYWISFYPGIALLLALVAINLVGD
RLREVLNPRAYR