Protein Info for RPSI07_RS14825 in Ralstonia solanacearum PSI07

Annotation: energy transducer TonB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03544: TonB_C
  • amino acids 142 to 219 (78 residues), 63.7 bits, E=9.1e-22
• TIGR01352: TonB family C-terminal domain
  • amino acids 145 to 219 (75 residues), 55.2 bits, E=3.5e-19

Best Hits

KEGG orthology group: K03832, periplasmic protein TonB (inferred from 96% identity to rso:RSc1963)

Predicted SEED Role

"Ferric siderophore transport system, periplasmic binding protein TonB" in subsystem Campylobacter Iron Metabolism or Hemin transport system or Ton and Tol transport systems

Protein Sequence (221 amino acids)

>RPSI07_RS14825 energy transducer TonB (Ralstonia solanacearum PSI07)
MIHPRTLKILVVVLLMHVGVLTLIQLGLIASPLRQEPPPELQVNIIPDTPPQPVRQPEPP
KPEPAKPAPPKQVNIVKPAPQPKPAPTPAPALPPSDTAPVVPAAPPTPPAPPVEAAPAPA
PAPVQSGPINVGINDIQCNNPPLVYPTMSQKMGEEGRTLVKITIGPDGDVVNAAVATSSG
SARLDRAALDSARSLHCSPYKQNGRVMTVVANKPFVFKLDN